The domain within your query sequence starts at position 130 and ends at position 244; the E-value for the EIF_2_alpha domain shown below is 1e-40.
LFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAV KIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTTLER
EIF_2_alpha |
 |
|---|
| PFAM accession number: | PF07541 |
|---|---|
| Interpro abstract (IPR011488): | In Eukaryota and Archaea, translation initiation factor 2 (eIF2/aIF2), which contains three subunits (alpha, beta and gamma), is pivotal for binding of charged initiator tRNA to the small ribosomal subunit. This entry represents the alpha subunit of both eukaryota and archaeal translation initiator factor 2. |
| GO function: | translation initiation factor activity (GO:0003743), RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EIF_2_alpha