The domain within your query sequence starts at position 1 and ends at position 146; the E-value for the EIN3 domain shown below is 3.5e-18.

TEGLKPPLRHALNLSQEKVEMEDSELDTQYLQNTFQVSKRQSFALFSKPRSPQKDCAHSV
PSKELSPKVTAKGKQKERQGQEEFEISHVQAVAATVGLPVPCQEVSPIRSSIKTDNRKPL
TEGRFERHTSSTEMAVGNENILQSTV

EIN3

EIN3
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EIN3