The domain within your query sequence starts at position 1 and ends at position 146; the E-value for the EIN3 domain shown below is 3.5e-18.

TEGLKPPLRHALNLSQEKVEMEDSELDTQYLQNTFQVSKRQSFALFSKPRSPQKDCAHSV
PSKELSPKVTAKGKQKERQGQEEFEISHVQAVAATVGLPVPCQEVSPIRSSIKTDNRKPL
TEGRFERHTSSTEMAVGNENILQSTV

EIN3

 EIN3
PFAM accession number:PF04873
Interpro abstract (IPR006957):

Ethylene insensitive 3 (EIN3) proteins are a family of plant DNA-binding proteins that regulate transcription in response to the gaseous plant hormone ethylene, and are essential for ethylene-mediated responses. In the presence of ethylene, dark-grown dicotyledonous seedlings undergo dramatic morphological changes collectively known as the 'triple response'. In Arabidopsis, these changes consist of a radial swelling of the hypocotyl, an exaggeration in the curvature of the apical hook, and the inhibition of cell elongation in the hypocotyl and root [ (PUBMED:9215635) (PUBMED:10508761) ].

GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EIN3