The domain within your query sequence starts at position 112 and ends at position 242; the E-value for the ELFV_dehydrog_N domain shown below is 1.3e-63.

CNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYK
CAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
EMSWIADTYAS

ELFV_dehydrog_N

 ELFV_dehydrog_N
PFAM accession number:PF02812
Interpro abstract (IPR006097):

Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related. They contain a Gly-rich region containing a conserved Lys residue, which has been implicated in the catalytic activity, in each case a reversible oxidative deamination reaction.

Glutamate dehydrogenases ( EC 1.4.1.2 EC 1.4.1.3 and EC 1.4.1.4 ) (GluDH) are enzymes that catalyse the NAD- and/or NADP-dependent reversible deamination of L-glutamate into alpha-ketoglutarate [ (PUBMED:1358610) (PUBMED:8315654) ]. GluDH isozymes are generally involved with either ammonia assimilation or glutamate catabolism. Two separate enzymes are present in yeasts: the NADP-dependent enzyme, which catalyses the amination of alpha-ketoglutarate to L-glutamate; and the NAD-dependent enzyme, which catalyses the reverse reaction [ (PUBMED:2989290) ] - this form links the L-amino acids with the Krebs cycle, which provides a major pathway for metabolic interconversion of alpha-amino acids and alpha- keto acids [ (PUBMED:3368458) ]. In rice, glutamate dehydrogenase 3 is mitochondrial.

Leucine dehydrogenase ( EC 1.4.1.9 ) (LeuDH) is a NAD-dependent enzyme that catalyses the reversible deamination of leucine and several other aliphatic amino acids to their keto analogues [ (PUBMED:3069133) ]. Each subunit of this octameric enzyme from Bacillus sphaericus contains 364 amino acids and folds into two domains, separated by a deep cleft. The nicotinamide ring of the NAD+ cofactor binds deep in this cleft, which is thought to close during the hydride transfer step of the catalytic cycle.

Phenylalanine dehydrogenase ( EC 1.4.1.20 ) (PheDH) is na NAD-dependent enzyme that catalyses the reversible deamidation of L-phenylalanine into phenyl-pyruvate [ (PUBMED:1880121) ].

Valine dehydrogenase ( EC 1.4.1.8 ) (ValDH) is an NADP-dependent enzyme that catalyses the reversible deamidation of L-valine into 3-methyl-2-oxobutanoate [ (PUBMED:8320231) ].

This entry represents the dimerisation region of these enzymes.

GO process:cellular amino acid metabolic process (GO:0006520), oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELFV_dehydrog_N