The domain within your query sequence starts at position 46 and ends at position 76; the E-value for the ELM2 domain shown below is 5e-9.
IRVGTNYQAVIPECKPESPARYSNKELKGML
ELM2 |
---|
PFAM accession number: | PF01448 |
---|---|
Interpro abstract (IPR000949): | The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex [ (PUBMED:10226007) ]. The domain is usually found to the N terminus of a myb-like DNA binding domain and a GATA binding domain. ELM2, in some instances, is also found associated with the ARID DNA binding domain IPR001606 . This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELM2