The domain within your query sequence starts at position 304 and ends at position 487; the E-value for the ELMO_CED12 domain shown below is 3.7e-48.

LTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNVPGSGTEKRKAMYTKDYKM
LGFTNHINPALDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAI
ELTKMLCEILQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFN
KVMQ

ELMO_CED12

ELMO_CED12
PFAM accession number:PF04727
Interpro abstract (IPR006816):

This entry represents the ELMO (EnguLfment and Cell MOtility) domain, which is found in a number of eukaryotic proteins involved in the cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility, including CED-12, ELMO-1 and ELMO-2.

ELMO-1 and ELMO-2 are components of signalling pathways that regulate phagocytosis and cell migration and are mammalian orthologues of the Caenorhabditis elegans gene, ced-12 that is required for the engulfment of dying cells and cell migration. ELMO-1/2 act in association with DOCK1 and CRK. ELMO-1/2 interact with the SH3-domain of DOCK1 via an SH3-binding site to enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1. ELMO-1/2 could be part of a complex with DOCK1 and Rac1 that could be required to activate Rac Rho small GTPases. Regulatory GTPases in the Ras superfamily employ a cycle of alternating GTP binding and hydrolysis, controlled by guanine nucleotide exchange factors and GTPase-activating proteins (GAPs), as essential features of their actions in cells. Within the Ras superfamily, the Arf family is composed of 30 members, including 22 Arf-like (Arl) proteins. The ELMO domain has been proposed to be a GAP domain for ARL2 and other members of the Arf family [(PUBMED:17452337)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELMO_CED12