The domain within your query sequence starts at position 722 and ends at position 955; the E-value for the ELYS domain shown below is 2.5e-58.

CLMIDGLVSQLGDEVEKLWKRDEGGTGRYPPASIHALLDIYLLDNITEASKHAITIYLLL
DIMYSFPNKTDTPIESFPTAFAISWGQVKLVQGFWLLDHNDYENGLDLLFHPVTAKPASW
QHSKIIEAFMSQGEHKQALRYLQTMKPTVSSSNEVILHLTVLLFNRCMVEAWNLLRQNSN
RVNIEELLKHAYEVCQEMGLMEDLLKLPFTNTEQECLVKFLQSSTSVENHEFLL

ELYS

ELYS
PFAM accession number:PF13934
Interpro abstract (IPR025151):

This domain is found in ELYS (embryonic large molecule derived from yolk sac), which is conserved from fungi such Aspergillus nidulans and Schizosaccharomyces pombe to humans [(PUBMED:17235358)]. ELYS is important for the assembly of the nuclear pore complex [(PUBMED:19019988)]. The domain is also found in other proteins, such as E3 ubiquitin-protein ligase HOS1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELYS