The domain within your query sequence starts at position 1 and ends at position 489; the E-value for the ELYS-bb domain shown below is 1.6e-307.

MQDLTAQVTSDLLHFPEVTIEALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSL
TGERLSAYRFSGVNEQPPVVLAVKEFSWHKRTGLLIGLEEADGSVLCLYDLGISRVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLIDLCLDDLSCSQN
EVEASDLEVITGIPAEVPHIRERVMREGRHLCFQLVSPLGVAISTLSYINRTNQLAVGFS
DGYLALWNMKSMKREYYTQLEGGRVPVHAVAFQEPENDPRNCCYLWAVQSTQDSEGDVLS
LHLLQLAFGDRKCLASGQILYEGLEYCEERYTLDLAGGTFPLRGQTSNTKLLGCQSIERF
PSHGDREESMREALSPDTSVSVFTWQVNIYGQGKPSVYLGLFDINRWYHAQMPDSLRSGE
SLHNCSYFALWSLDSVVSRTSPHHILDILVHERSLNRGVPPSYPPPEQFFNPSTFNFDAT
CLLDSGVIH

ELYS-bb

ELYS-bb
PFAM accession number:PF16687
Interpro abstract (IPR032040):

This entry represents the N-terminal seven-bladed beta-propeller domain of ELYS nucleoporins in higher eukaryotes. It is required for anchorage of the nucleoporin to the nuclear envelope during cell-division [(PUBMED:23499022)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELYS-bb