The domain within your query sequence starts at position 57 and ends at position 390; the E-value for the EMP70 domain shown below is 1.7e-103.

ETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQV
EQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIF
ANVSVRDVKPHSLDGLRSDELLGLTHTYSVRWSETSVEHRSDRRRGDDGGFFPRTLEIHW
LSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETSSGGSSDDFDQGDNGWKIIHTD
VFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYALTCCIS
GYVSSHFYRQIGGERWVWNIILTSSLFSGAAGHN

EMP70

EMP70
PFAM accession number:PF02990
Interpro abstract (IPR004240): The transmembrane 9 superfamily protein (TM9SF) may function as a channel or small molecule transporter. Proteins in this group are endosomal integral membrane proteins.
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EMP70