The domain within your query sequence starts at position 1 and ends at position 461; the E-value for the EP400_N domain shown below is 1.6e-232.

MHHGSGPQNVQHQLQRSRSFTGSEEEQPAHPNLPPSPAAPFAPSASPSAPQSPGYQIQQL
MSRSPVAGQNVNITLQNVGPVVGGNQQITLAPLPLPNPTSPGFQFGAQQRRFEHGSPSYI
QVTSPMSQQVQTQSPTQPSPGPGQTLQNVRAGAPGPGLGICSNSPTGGFVDASVLVRQIS
LSPSSGGHFVFQEAPGLTQMAQGAQVQLQHSGAPITVRERRLSQPHAQSGGTIHHLGPQS
PAAAGGTGLQPLASPNHITTASLPPQISSIIQGQLIQQQQQVLQGQPMNRSLGFERTPGV
LLPGVGGPSAFGMTSPPPPTSPSRTTMPPGLSSVPLTSMGSSGMKKVPKKLEEIPPASQE
MAQMRKQCLDYHYKEMEALKEVFKEYLIELFFLQHLQGNMMDFLAFKKKHYAPLQAYLRQ
NDLDIEEEEEEEEEEEGKSEVINDEHQSLTGSLVVGPGSAT

EP400_N

EP400_N
PFAM accession number:PF15790
Interpro abstract (IPR031575):

This entry represents the N-terminal domain of EP400, a component of the NuA4 histone acetyltransferase complex that was first identified through its ability to bind the adenovirus E1A protein [(PUBMED:11509179), (PUBMED:15741165)]. The exact function of this domain is not known. This domain is largely low-complexity residues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EP400_N