The domain within your query sequence starts at position 21 and ends at position 118; the E-value for the ER domain shown below is 4.6e-49.

SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFI
DDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQA

ER

ER
PFAM accession number:PF01133
Interpro abstract (IPR000781): The Drosophila protein 'enhancer of rudimentary' (gene (e(r)) is a small protein of 104 residues whose function is not yet clear. From an evolutionary point of view, it is highly conserved [(PUBMED:9074495)] and has been found to exist in probably all multicellular eukaryotic organisms. It has a role in pyrimidine biosynthesis and the cell cycle [(PUBMED:9074495)]. Drosophila enhancer of rudimentary protein is a positive regulator of the Notch signalling pathway [(PUBMED:21904119)].
GO process:cell cycle (GO:0007049), positive regulation of Notch signaling pathway (GO:0045747), pyrimidine nucleotide biosynthetic process (GO:0006221)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ER