The domain within your query sequence starts at position 117 and ends at position 188; the E-value for the ERG2_Sigma1R domain shown below is 1.5e-27.

SGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYA
RGLRLELTTYLF

ERG2_Sigma1R

ERG2_Sigma1R
PFAM accession number:PF04622
Interpro abstract (IPR006716):

This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyses a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols [ (PUBMED:8082205) ]. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum [ (PUBMED:8755605) ], which interacts with endogenous steroid hormones, such as progesterone and testosterone [ (PUBMED:9425306) ]. It also binds the sigma ligands, which are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine [ (PUBMED:8755605) ]. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERG2_Sigma1R