The domain within your query sequence starts at position 6 and ends at position 101; the E-value for the ERGIC_N domain shown below is 2.2e-38.

KLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRG
DKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEH

ERGIC_N

ERGIC_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERGIC_N