The domain within your query sequence starts at position 7 and ends at position 97; the E-value for the ERGIC_N domain shown below is 9e-35.

LKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGD
KLKINIDVLFPHMPCAYLSIDAMDVAGEQQL

ERGIC_N

ERGIC_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERGIC_N