The domain within your query sequence starts at position 60 and ends at position 453; the E-value for the ERO1 domain shown below is 3.7e-128.

RLFPRLQKLLESDYFRYYKVNLKKPCPFWNDINQCGRRDCAVKPCHSDEVPDGIKSASYK
YSEEANRIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDSFCEIDDIQSPDAEYVD
LLLNPERYTGYKGPDAWRIWSVIYEENCFKPQTIQRPLASGRGKSKENTFYNWLEGLCVE
KRAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNVTEFQQRFDGILTEGEGPRRLRN
LYFLYLIELRALSKVLPFFERPDFQLFTGNKVQDAENKALLLEILHEIKSFPLHFDENSF
FAGDKNEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIAN
MPESGPSYEFQLTRQEIVSLFNAFGRISTSVREL

ERO1

ERO1
PFAM accession number:PF04137
Interpro abstract (IPR007266):

This entry represents endoplasmic oxidoreductin-1 (Ero1) from yeast and its homologues from mammals, Ero1-Lalpha and Ero1-Lbeta. Ero1 is an essential oxidoreductase that oxidises proteins in the endoplasmic reticulum to produce disulfide bonds [(PUBMED:10754564), (PUBMED:10982384), (PUBMED:22412017)]. The activity of Ero1 is regulated by Pdi1, which is a protein disulfide isomerase. This regulation of Ero1 through reduction and oxidation of regulatory bonds within Ero1 is essential for maintaining the proper redox balance in the ER [(PUBMED:22412017), (PUBMED:18971943)].

GO process:oxidation-reduction process (GO:0055114)
GO component:endoplasmic reticulum (GO:0005783)
GO function:oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor (GO:0016671), protein disulfide isomerase activity (GO:0003756)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERO1