SMART: Pfam domain ERp29

The domain within your query sequence starts at position 158 and ends at position 252; the E-value for the ERp29 domain shown below is 7.3e-26.

GCLPAYDALAGEFIKASSIEARQAILKQGQDGLLSVKETEKKWASQYLKIMGKILDQGED
FPASEMARIGKLIENKMSDSKKEELQKSLNILTAF

ERp29

PFAM accession number:	PF07749
Interpro abstract (IPR011679):	ERp29 (also known as ERp28 and ERp31) is a ubiquitously expressed endoplasmic reticulum protein found in mammals [ (PUBMED:11435111) ]. This protein has an N-terminal thioredoxin-like domain, which is homologous to the domain of human protein disulphide isomerase (PDI). ERp29 may help mediate the chaperone function of PDI. The C-terminal Erp29 domain has a 5-helical bundle fold. ERp29 is thought to form part of the thyroglobulin folding complex [ (PUBMED:11884402) ]. The Drosophila homologue, Wind, is the product of windbeutel, an essential gene in the development of dorsal-ventral patterning. Wind is required for correct targeting of Pipe, a Golgi-resident type II transmembrane protein with homology to 2-O-sulfotransferase. The C-terminal domain of Wind is thought to provide a distinct site required for interaction with its substrate, Pipe [ (PUBMED:12941941) ].
GO component:	endoplasmic reticulum (GO:0005783)

PFAM accession number:

PF07749

Interpro abstract (IPR011679):

ERp29 (also known as ERp28 and ERp31) is a ubiquitously expressed endoplasmic reticulum protein found in mammals [ (PUBMED:11435111) ]. This protein has an N-terminal thioredoxin-like domain, which is homologous to the domain of human protein disulphide isomerase (PDI). ERp29 may help mediate the chaperone function of PDI. The C-terminal Erp29 domain has a 5-helical bundle fold. ERp29 is thought to form part of the thyroglobulin folding complex [ (PUBMED:11884402) ].

The Drosophila homologue, Wind, is the product of windbeutel, an essential gene in the development of dorsal-ventral patterning. Wind is required for correct targeting of Pipe, a Golgi-resident type II transmembrane protein with homology to 2-O-sulfotransferase. The C-terminal domain of Wind is thought to provide a distinct site required for interaction with its substrate, Pipe [ (PUBMED:12941941) ].

GO component:

endoplasmic reticulum (GO:0005783)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERp29