The domain within your query sequence starts at position 35 and ends at position 157; the E-value for the ERp29_N domain shown below is 9.3e-61.
LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSEELLVAEVG ISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDLENPVLYNGAVKVGAIQRWLKGQGVYL GMP
ERp29_N |
 |
|---|
| PFAM accession number: | PF07912 |
|---|---|
| Interpro abstract (IPR012883): | ERp29 ( P52555 ) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [ (PUBMED:10727933) (PUBMED:11435111) ]. The protein exists as a homodimer, with each monomer being composed of two domains. The N-terminal domain featured in this family is organised into a thioredoxin-like fold that resembles the a domain of human protein disulphide isomerase (PDI) [ (PUBMED:11435111) ]. However, this domain lacks the C-X-X-C motif required for the redox function of PDI; it is therefore thought that the function of ERp29 is similar to the chaperone function of PDI [ (PUBMED:11435111) ]. The N-terminal domain is exclusively responsible for the homodimerisation of the protein, without covalent linkages or additional contacts with other domains [ (PUBMED:11435111) ]. |
| GO process: | protein secretion (GO:0009306) |
| GO component: | endoplasmic reticulum lumen (GO:0005788) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERp29_N