The domain within your query sequence starts at position 556 and ends at position 599; the E-value for the ESR1_C domain shown below is 1.9e-25.

PASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI

ESR1_C

ESR1_C
PFAM accession number:PF12743
Interpro abstract (IPR024736):

This is the very C-terminal region of a subfamily of nuclear receptors that includes oestrogen receptors and other subfamily 3 group A members. The actual function of this region is not known, but the domain is absent from all the other types of nuclear receptors. Oestrogen receptors modulate AP-1-dependent transcription [(PUBMED:10751636)] through two distinct mechanisms: via protein-protein interactions on DNA; and via non-genomic actions. The mechanism used depends on the cellular localisation of the receptor. In addition to the more extensively studied cross-talk on DNA, additional non-genomic actions might be very important in target tissues in which membrane-associated ERs are found. These non-genomic actions probably contribute to the overall physiological responses mediated by ligand-bound ERs [(PUBMED:15196329)] and might possibly be mediated via this C-terminal domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ESR1_C