The domain within your query sequence starts at position 77 and ends at position 189; the E-value for the EST1 domain shown below is 1.1e-26.

KAEELLWRKVYYEVIQLIKTNKKHIHSRSTLECAYRTHLVAGIGFYQHLLLYIQSHYQLE
LQCCIDWTHVTDPLMGFKKPVSASGKEMDWAQMACHRCLVYLGDLSRYQNELA

EST1

EST1
PFAM accession number:PF10374
Interpro abstract (IPR019458):

Est1 is directly involved in telomere replication. It associates with telomerase and, during its interaction with CDC13, telomerase activity is promoted [(PUBMED:12169735), (PUBMED:12454059)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EST1