The domain within your query sequence starts at position 212 and ends at position 339; the E-value for the EST1_DNA_bind domain shown below is 7.3e-37.
ARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLF EETKRKAEQMEKKQHEEFDMSPDKWRKGKKSTFRHVGDDTTRLEIWIHPSHSRSAQGTES GKDSEQEN
EST1_DNA_bind |
---|
PFAM accession number: | PF10373 |
---|---|
Interpro abstract (IPR018834): | This entry represents a DNA/RNA binding domain found in the telomere elongation protein EST1 and related sequences, such as the nonsense-mediated mRNA decay pathway proteins SMG5 and SMG7 [ (PUBMED:12676088) (PUBMED:14636577) (PUBMED:15546618) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EST1_DNA_bind