The domain within your query sequence starts at position 750 and ends at position 1106; the E-value for the EST1_DNA_bind domain shown below is 1.6e-78.

ARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLF
EETKRKAEQMEKKQHEEFDMSPDKWRKGKKSTFRHVGDDTTRLEIWIHPSHSRSAQGTES
GKDSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHS
PSPIGSTRMLQLMTINMFAVHNSQLKDCFSEECRSVIQEQAASLGLAMFSLLVQRCTCLL
KDSAKAQLSSPEDQEDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLDLP
LQVAVDVWSTLADFCNILTAVNQSEVPLYKDPDDDLTLLILEEDRLLSGFVPLLAAP

EST1_DNA_bind

EST1_DNA_bind
PFAM accession number:PF10373
Interpro abstract (IPR018834):

This entry represents a DNA/RNA binding domain found in the telomere elongation protein EST1 and related sequences, such as the nonsense-mediated mRNA decay pathway proteins SMG5 and SMG7 [(PUBMED:12676088), (PUBMED:14636577), (PUBMED:15546618)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EST1_DNA_bind