The domain within your query sequence starts at position 79 and ends at position 865; the E-value for the ETAA1 domain shown below is < 1e-12.

KETPVQIVKMDLLSCTFSSPNDPDGQTDIFWDQNSPMTKQLGKGRKKQISSAYSDEISHI
VNRIAPQDEKPVTNSMLGVWIGETAIPCTPGVAKEKSRVKASCTKLKTKNREKELMKLAQ
QFDKNMEELDVIQEQDGKNHDFIQMTSKMGHLDNHKDSVQKPSGDVVPEITCTPVKKQMK
GDSRISLAKAQDSSQKPFDQNVEAAFNAIFDGSTQMCSGQLSQDLLDAFLNNSKTSLRKK
NALLQEEIITTETLLTENLLNKTPISLSPQIDTTVILNSCVTPCPKTPAAPDTQLDELTA
NDFEDDWESLLGSEPFLMENAEMLEFVPSTTAQDTCQKAICTSVGENDTITSRTNMNLGG
RLRDSKVTLDLPSKTRNGELRNAGEHRFSSHPGDESRKVPFTGNKVSFEKSVTSIVSKDE
DYVAVSNLEKVKEDSRNKCILNKHSSNKSSSYTRYPSKQSSELGVNLPLQVPTTDPFDSV
FLGKENIVCSTNQSHGSKLNSSFDDWNDPLLASEMVEACHRLEATWDAGEVDDDLFCQAC
DDIERLTQQENKGSEESESVSYTSTRGSRSSSTASKQASQSAPSKHWNVVSSAVPLSLAN
KSQMSKPVTVQKRGRCGDGPNILDATNLSVCSKNSSDNKRGPVQVNSSKFVLGGSSNLNV
NLGLMSTKIATNMKLSTQQLSHNSLADTAQNDNKILKLPKFTFKKKNPQLNQNHLVGSVP
VGKISEDLGKRETVNSLLEANQQQSSINYSESLKPSSPDEEERNRKYSPEEIQRKRQEAL
VRRKAKA

ETAA1

ETAA1
PFAM accession number:PF15350
Interpro abstract (IPR029406):

This family of proteins is found in eukaryotes, where members are expressed at high levels in the brain, liver kidney and Ewing tumour cell lines [(PUBMED:16003559)]. Proteins in this family are typically between 648 and 898 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ETAA1