The domain within your query sequence starts at position 19 and ends at position 73; the E-value for the ETC_C1_NDUFA5 domain shown below is 1.4e-24.
TPHERLTILYTKTLDILKHFPKHAAYRKYTEQITNEKLDMVKAEPDVKKLEALLQ
ETC_C1_NDUFA5 |
 |
|---|
| PFAM accession number: | PF04716 |
|---|---|
| Interpro abstract (IPR006806): | NDUFA5, also known as NADH-ubiquinone oxidoreductase 13kDa-B subunit, is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) [ (PUBMED:27626371) ]. |
| GO process: | respiratory electron transport chain (GO:0022904) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ETC_C1_NDUFA5