The domain within your query sequence starts at position 1 and ends at position 284; the E-value for the EURL domain shown below is 1.7e-164.

MNEEEQFVSIDLNDDNICSVCKLGTDKDTLSFCHICFELNLEGVPKSNLLHTKSVRGHKD
CFEKYHLIANQDCSRSKLSKSTYEGVKTIVSKKINWIVQYAQNKNLDLESECSKTSQHPL
LNFRHKPEKKLLPQFDSQVPKYSAKGSAGNAGSISSYAQRILEHRENTDFRLGLLEDADA
LWTHSHSQAQKTEETSSGPEGTIQTQNPHYSREELNSMTLAEVVQLSAKLQQRIQEVFEE
LTHQVQEKDSLASELHVRHVAIEQLLKNCSKLPCLQVGRTGTRS

EURL

EURL
PFAM accession number:PF06937
Interpro abstract (IPR009704):

This family consists of several animal EURL proteins. EURL is preferentially expressed in chick retinal precursor cells as well as in the anterior epithelial cells of the lens at early stages of development. EURL transcripts are found primarily in the peripheral dorsal retina, i.e., the most undifferentiated part of the dorsal retina. EURL transcripts are also detected in the lens at stage 18 and remain abundant in the proliferating epithelial cells of the lens until at least day 11. The distribution pattern of EURL in the developing retina and lens suggest a role before the events leading to cell determination and differentiation [ (PUBMED:12815627) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EURL