The domain within your query sequence starts at position 147 and ends at position 570; the E-value for the EVC2_like domain shown below is 2.1e-191.

GECYSVSYTASLDPTALGTGESLDLPARLIFQSPSQNRTQLKAPFTITVEEKIMVLPNHG
LHAAGFIAAFLISLLLTVAALFFLARGRCLQGGMLSRCRIQHPENKLEPSPFTSANGVSQ
DLSLNDQVVAILTSEEPGSMLQALEELEIATLNQADADLEACRNQISKDIIALLMKNLVS
GGHLSPQTERKMAAAFKKQFLLLENEIQEEYERKMLALTAECDLEMRKKTENQYQREMVA
MEEAEEVLKRVSERSAAECSSLLRTLHGLEQEDMQRSLTLDQAEDFAQAHRQLAVFQRNE
LHSIVYTQIQSAVSKGELRPEVAKMMLQDYSKTQESVEELMDFFQATKRYHLSKRFGHRE
YLVQRLQAMETRVQGLLNTAATQLTSLIHKHERAGYLDEDQMETLLERAQTETFSIKQKL
DNDL

EVC2_like

EVC2_like
PFAM accession number:PF12297
Interpro abstract (IPR022076):

Limbin (EVC2) interacts with AVC and is a positive regulator of the hedgehog signaling pathway. It plays a critical role in bone formation and skeletal development and may be involved in early embryonic morphogenesis [(PUBMED:21356043)].

GO process:smoothened signaling pathway (GO:0007224)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EVC2_like