The domain within your query sequence starts at position 56 and ends at position 220; the E-value for the EVE domain shown below is 3.7e-57.
NYWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFY HSNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIP LEELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSL
EVE |
![]() |
---|
PFAM accession number: | PF01878 |
---|---|
Interpro abstract (IPR002740): | The EVE domain is part of the wider PUA domain superfamily. The function of this domain is not known but, given the structural similarities to PUA, is likely to involve RNA binding [ (PUBMED:19191354) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EVE