The domain within your query sequence starts at position 28 and ends at position 59; the E-value for the EVI2A domain shown below is 6.2e-14.

MEHKGQYLHLVFLMTTVWASSSSGTRPNYTHL

EVI2A

 EVI2A
PFAM accession number:PF05399
Interpro abstract (IPR008608):

This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [ (PUBMED:2167436) (PUBMED:2117566) ].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EVI2A