The domain within your query sequence starts at position 28 and ends at position 59; the E-value for the EVI2A domain shown below is 6.2e-14.
MEHKGQYLHLVFLMTTVWASSSSGTRPNYTHL
EVI2A |
---|
PFAM accession number: | PF05399 |
---|---|
Interpro abstract (IPR008608): | This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [ (PUBMED:2167436) (PUBMED:2117566) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EVI2A