The domain within your query sequence starts at position 64 and ends at position 94; the E-value for the EXOSC1 domain shown below is 7.9e-10.
LPDVGAVVTCKVEIYKSFRPGDIVLAKVISL
EXOSC1 |
 |
|---|
| PFAM accession number: | PF10447 |
|---|---|
| Interpro abstract (IPR019495): | Exosome is a complex of 3' --> 5' exoribonucleases that play a major role in diverse RNA processing and degradation pathways. The eukaryotic exosome complex contains 9 proteins. Six RNase PH domain containing proteins (Rrp41, Rrp42, Rrp43, Rrp45, Rrp46, and Mtr3) form a catalytic ring, three RNA binding domain containing proteins (Rrp4,Rrp40, and Csl4) bind on top of the ring [ (PUBMED:17174896) ]. This entry represents the C-terminal domain of the exosome complex component CSL4 (also known as EXOSC1). CSL4 does not have exonuclease activity, but are required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay [ (PUBMED:10465791) (PUBMED:17173052) ]. |
| GO component: | exosome (RNase complex) (GO:0000178) |
| GO function: | RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EXOSC1