The domain within your query sequence starts at position 578 and ends at position 808; the E-value for the E_Pc_C domain shown below is 2.1e-70.

GITEEQFQTHQQQLVQMQRQQLAQLHQKQQSQHSSQQTHPKAQGSSTSDCMSKTLDSASA
HFAASAVVSAPVPSRSEGSKEQNTGHNNMNGVVQPSGPSKTLYSTNMALSSSPGISAVQL
VRTVGHTTTNHLIPALCTSSPQTLPMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPT
ALKLATVAASMDRVPKVTPSSAISSIARENHEPERLGLNGLAETTVAMEVT

E_Pc_C

E_Pc_C
PFAM accession number:PF06752
Interpro abstract (IPR009607):

This entry represents the C terminus of eukaryotic enhancer of polycomb proteins, which have roles in heterochromatin formation [(PUBMED:9735366)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E_Pc_C