The domain within your query sequence starts at position 5 and ends at position 58; the E-value for the EamA domain shown below is 1.5e-6.

VSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLVPIISGVLLATV

EamA

EamA
PFAM accession number:PF00892
Interpro abstract (IPR000620): EamA (named after the O-acetyl-serine/cysteine export gene in E. coli) domain is found in a wide range of proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation, the Salmonella typhimurium PagO protein (function unknown), and some members of the solute carrier family group 35 (SLC35) nucleoside-sugar transporters. Many members of this family are classed as drug/metabolite transporters and have no known function. They are predicted to be integral membrane proteins and many of the proteins contain two copies of this domain [(PUBMED:11432728)].
GO component:membrane (GO:0016020), integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EamA