The domain within your query sequence starts at position 49 and ends at position 143; the E-value for the EcKinase domain shown below is 4.8e-9.

YGTGVGYCKRQVSTWTKQYQASAHQSIPAMDQLSTWLMKNLPDSDSEECLVHGDFKLDNI
VFHPKECRVIAVLDWELSTFGHPLTDLAHLSLFYY

EcKinase

EcKinase
PFAM accession number:PF02958
Interpro abstract (IPR004119): This is a protein family of unknown function. Some sequences have been annotated as ecdysteroid kinases, but this has not yet been confirmed experimentally.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EcKinase