The domain within your query sequence starts at position 10 and ends at position 517; the E-value for the Ecm29 domain shown below is 4e-163.

LERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVRKKVMELLVHLNKRIKSRPKI
QLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPRLPVEKQCELAPTLLTAMEGKPQPQQD
SLMHLLIPTLFHMKYPAESSKSASPFNLAEKPKTVQLLLDFMLDVLLMPYGYVLNESQSR
QNSSSSSQGSSSNSGGGSGIPQPPPGMSFYAAKRVIGDNPWTPEQLEQCKLGIVKFIEAE
QVPELEAVLHLVIASSDTRHSVATAADLELKSKQSLIDWNNPAIINKMYKVYLGDIPLKT
KEGAVLKPELKRDPVSTRVKLKIVPHLLRSRQAAETFPANIQVVYDGLFGTNTNSKLRTL
SLQFVHHICLTCPEIKIKPLGPMLLNGLTKLINEYKEDPKLLSMAYSAVGKLSSRMPHLF
TKDIALVQQLFEALCKEEPETRLAIQEALSMMVGAYSTLEGAQRTLMEALVASYLIKPEV
QVRQVAVKFASTVFPSDHIPSRYLLLLA

Ecm29

Ecm29
PFAM accession number:PF13001
Interpro abstract (IPR024372):

The proteasome (or macropain) (EC 3.4.25.1) [(PUBMED:7682410), (PUBMED:2643381), (PUBMED:1317508), (PUBMED:7697118), (PUBMED:8882582)] is a multicatalytic proteinase complex in eukaryotes and archaea, and in some bacteria, that is involved in an ATP/ubiquitin-dependent non-lysosomal proteolytic pathway. In eukaryotes the 20S proteasome is composed of 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Proteasome subunits can be classified on the basis of sequence similarities into two groups, alpha (A) and beta (B). The proteasome consists of four stacked rings composed of alpha/beta/beta/alpha subunits. There are seven different alpha subunits and seven different beta subunits [(PUBMED:9087403)]. Three of the seven beta subunits are peptidases, each with a different specificity. Subunit beta1c (MEROPS identifier T01.010) has a preference for cleaving glutaminyl bonds ("peptidyl-glutamyl-like" or "caspase-like"), subunit beta2c (MEROPS identifier T01.011) has a preference for cleaving arginyl and lysyl bonds ("trypsin-like"), and subunit beta5c (MEROPS identifier T01.012) cleaves after hydrophobic amino acids ("chymotrypsin-like") [(PUBMED:2535672)]. The proteasome subunits are related to N-terminal nucleophile hydrolases, and the catalytic subunits have an N-terminal threonine nucleophile.

Ecm29 is an adapter/scaffolding protein that tethers the proteasome core particle to the regulatory particle, stabilising the interaction between these two components [(PUBMED:12408819), (PUBMED:15496406), (PUBMED:18026118)].
GO process:proteasome assembly (GO:0043248)
GO function:protein-containing complex scaffold activity (GO:0032947)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ecm29