The domain within your query sequence starts at position 3 and ends at position 108; the E-value for the Elf-1_N domain shown below is 8.6e-38.

TSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFV
PPCISTPEFIHAAMRPDVITETVVEVSTEESEPMDASPIPTSPDSH

Elf-1_N

Elf-1_N
PFAM accession number:PF12310
Interpro abstract (IPR022084):

Elf (E74-like-factor) is a subfamily of the ETS transcription factor family [(PUBMED:11715049)]. Elf-1 is an immune cell specific transcription factor. It is found in T cells, B cells, megakaryocytes,and mast cells and is involved in the control of transcription for various immune proteins [(PUBMED:11210123)]. Included in the Elf subfamily are also Elf-2 (NERF) [(PUBMED:8756667)] and Elf4 (MEF) [(PUBMED:19412182)].

This entry represents a domain found in the N terminus of Elf transcription factors. It is approximately 110 amino acids in length and is found in association with. It contains a conserved PAVIVE sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Elf-1_N