The domain within your query sequence starts at position 80 and ends at position 248; the E-value for the EloA-BP1 domain shown below is 1.6e-64.

KPVIPKEFGGTVPIVVPQGYLHLFIEEFLKFCSSKQEAIEKALNGEKVAYDLSSSKNIYL
NVAVNILKKLRGLAPNTMLNLSKASGRRVVSHEVVLGGKLAAKTSFSLNSPSSQQVEELR
ALIPSASAGYALYCHLREYLLTQEQLKENGYPFPHPERPGAAVIFTAKE

EloA-BP1

EloA-BP1
PFAM accession number:PF15870
Interpro abstract (IPR031736):

This domain is found in elongin A binding-protein 1, also known as RNA exonuclease 1 homologue [(PUBMED:12943681)]. The function of this domain is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EloA-BP1