The domain within your query sequence starts at position 80 and ends at position 248; the E-value for the EloA-BP1 domain shown below is 1.6e-64.
KPVIPKEFGGTVPIVVPQGYLHLFIEEFLKFCSSKQEAIEKALNGEKVAYDLSSSKNIYL NVAVNILKKLRGLAPNTMLNLSKASGRRVVSHEVVLGGKLAAKTSFSLNSPSSQQVEELR ALIPSASAGYALYCHLREYLLTQEQLKENGYPFPHPERPGAAVIFTAKE
EloA-BP1 |
---|
PFAM accession number: | PF15870 |
---|---|
Interpro abstract (IPR031736): | This domain is found in elongin A binding-protein 1, also known as RNA exonuclease 1 homologue [ (PUBMED:12943681) ]. The function of this domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EloA-BP1