The domain within your query sequence starts at position 1 and ends at position 201; the E-value for the Elong_Iki1 domain shown below is 1.1e-12.

MLDSLLAIGGLVLLRDSVEWEGRSLLKALIKKSALRGEQVHVLGCEVSEEEFREGFDSDV
NSRLVYHDLFRDPLNWSKPGEAVPEGPLKALRSMCKRTDHGSVTIALDSLSWLLCHIPCV
TLCQALHALSQQNGDPGDNSLVEQVRVLGLLHEELHGPGSMGALNTLAHTEVTLSGKVDQ
TSASILCRRPQQRATYQTWWF

Elong_Iki1

• PFAM accession number: PF10483
• Interpro abstract (IPR019519):

  Elongator is a 6 subunit protein complex highly conserved in eukaryotes. The human Elongator six-subunit complex, known as holo-Elongator, has histone acetyltransferase activity directed against histone H3 and H4 [ (PUBMED:11714725) (PUBMED:11904415) ]. It consists of two subcomplexes, a core subcomplex (ELP1-3), and an accessory subcomplex (ELP4-6) [ (PUBMED:22556426) ]. The elongator complex has been associated with many cellular activities, including transcriptional elongation [ (PUBMED:10024884) (PUBMED:11689709) ], but its main function is tRNA modification [ (PUBMED:15769872) (PUBMED:23165209) ]. It is required for the formation of 5-methoxy-carbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups on uridine nucleosides present at the wobble position of many tRNAs [ (PUBMED:22889844) ].

  This entry represents Elongator complex protein 5 (ELP5).

• GO process: tRNA wobble uridine modification (GO:0002098)
• GO component: Elongator holoenzyme complex (GO:0033588)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Elong_Iki1