The domain within your query sequence starts at position 89 and ends at position 219; the E-value for the Endomucin domain shown below is 4.8e-80.
HEAENQSSIRTTEISVTTQLLDALPKITATSSASLTTAHTMSLLQDTEDRKIATTPSTTP SYSSIILPVVIALVVITLLVFTLVGLYRICWKRDPGTPENGNDQPQSDKESVKLLTVKTI SHESGEHSAQG
Endomucin |
![]() |
---|
PFAM accession number: | PF07010 |
---|---|
Interpro abstract (IPR010740): | Endomucin, also known as sialomucin or mucin-like sialoglycoprotein, is a membrane-bound glycoprotein expressed luminally by endothelial cells that line postcapillary venules, a primary site of leukocyte recruitment during inflammation [ (PUBMED:26831939) ]. It interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix [ (PUBMED:11418125) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Endomucin