The domain within your query sequence starts at position 1 and ends at position 160; the E-value for the Endonuclease_5 domain shown below is 3.3e-50.
MVGLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLG VLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHS TKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRS
Endonuclease_5 |
---|
PFAM accession number: | PF04493 |
---|---|
Interpro abstract (IPR007581): | Endonuclease V is specific for single-stranded DNA, for duplex DNA that contains uracil, or that is damaged [ (PUBMED:8990280) ]. Matrix metalloproteinase-1 (MMP-1) is the major enzyme responsible for collagen 1 digestion. It is induced by exposure to sunlight, but is reduced with treatment of DNA repair enzyme endonuclease V [ (PUBMED:18459971) ]. This family consequently has potential medical importance [ (PUBMED:18328204) ]. This endonuclease also appears in bifunctional enzymes, such as the bifunctional methyltransferase/endonuclease in Thermoplasma acidophilum. |
GO process: | DNA repair (GO:0006281) |
GO function: | endonuclease activity (GO:0004519) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Endonuclease_5