The domain within your query sequence starts at position 1112 and ends at position 1362; the E-value for the Endostatin domain shown below is 2.8e-102.

NLVTALSDMGDMLQKAHLVIEGTFIYLRDSGEFFIRVRDGWKKLQLGELIPIPADSPPPP
ALSSNPYQPQPPLNPILSANYERPVLHLVALNTPVAGDIRADFQCFQQARAAGLLSTFRA
FLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFDGRDV
MTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRTTDMAVTGFASPLSTGKILDQKAYSCANR
LIVLCIENSFM

Endostatin

Endostatin
PFAM accession number:PF06482
Interpro abstract (IPR010515):

NC10 stands for Non-helical region 10 and is taken from P39059. A mutation in this region in P39060 is associated with an increased risk of prostrate cancer. This domain is cleaved from the precursor and forms endostatin. Endostatin is a key tumour suppressor and has been used highly successfully to treat cancer. It is a potent angiogenesis inhibitor [(PUBMED:11606364)].

Endostatin is a C-terminal fragment of collagen XV/XVIII, a proteoglycan/collagen found in vessel walls and basement membranes. This domain has a compact globular fold similar to that of C-type lectins. Endostatin XVIII is monomeric and contains a heparin-binding epitope and zinc binding sites [(PUBMED:10704302)] while endostatin XV is trimeric and contains neither of these sites. The generation of endostatin or endostatin-like collagen XV/XVIII fragments is catalyzed by proteolytic enzymes within the protease-sensitive hinge region of the C-terminal domain. Endostatin inhibits endothelial cell migration in vitro and appears to be highly effective in murine in vivo studies [(PUBMED:10885579),(PUBMED:11191058)].

GO process:cell adhesion (GO:0007155)
GO component:extracellular matrix (GO:0031012)
GO function:structural molecule activity (GO:0005198)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Endostatin