The domain within your query sequence starts at position 87 and ends at position 210; the E-value for the Ependymin domain shown below is 1e-40.
PCKRLFEYILLYKEGVMFQIEQATKQCAKIPLVESWDPLDIPQNSTFEDQYSIGGPQEQI LVQEWSDRRTARSYETWIGVYTAKDCYPVQETFIRNYTVVMSTRFFDVQLGIKDPSVFTP PSTC
Ependymin |
---|
PFAM accession number: | PF00811 |
---|---|
Interpro abstract (IPR001299): | Ependymins are secretory proteins found predominantly in the cerebrospinal fluid of teleost fish [ (PUBMED:1831964) (PUBMED:8350351) ]. A bound form of the glycoproteins is associated with the extracellular matrix, probably with collagen fibrils, that may be the functional form of ependymins [ (PUBMED:8005346) ]. The proteins bind calcium via N-linked sialic acid residues. The molecular function of ependymins appear to be related to cell contact phenomena involving the extracellular matrix [ (PUBMED:8005346) ]. |
GO process: | cell-matrix adhesion (GO:0007160) |
GO component: | extracellular region (GO:0005576) |
GO function: | calcium ion binding (GO:0005509) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ependymin