The domain within your query sequence starts at position 557 and ends at position 630; the E-value for the EphA2_TM domain shown below is 4.4e-25.

IIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYED
PNRAVHQFAKELDA

EphA2_TM

EphA2_TM
PFAM accession number:PF14575
Interpro abstract (IPR027936):

This entry represents the left-handed dimer transmembrane domain of Ephrin receptors. This domain oligomerises and is important for the active signalling process [(PUBMED:20197042)].

Proteins containing this domain include the ephrin type-A and type-B receptors. Ephrin receptors (Ephs) are a group of receptor tyrosine kinases that are activated in response to binding ephrin ligands residing on adjacent cells [(PUBMED:12094214)]. This binding leads to contact-dependent bidirectional signaling into neighbouring cells [(PUBMED:12094214)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EphA2_TM