The domain within your query sequence starts at position 1518 and ends at position 1605; the E-value for the Epiglycanin_C domain shown below is 3.8e-22.
GTPVMEVKPSGSLKPWEIFLITLASVIVVMGLSAGLFIYVRRYLSLRNAADGIFYNSHPD PGGSAMTPGSPTCSWRRPRTFNVVEMTR
Epiglycanin_C |
---|
PFAM accession number: | PF14654 |
---|---|
Interpro abstract (IPR028199): | This entry represents the non-tandem repeat domain including cleavage site, the transmembrane helix domain, and the cytoplasmic tail of epiglycanin (mucin-21) and related mucins [ (PUBMED:17977904) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Epiglycanin_C