The domain within your query sequence starts at position 14 and ends at position 110; the E-value for the Epimerase domain shown below is 1.2e-13.

NRRRMKLLLGIALFAYAAFDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVG
ARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACY

Epimerase

Epimerase
PFAM accession number:PF01370
Interpro abstract (IPR001509):

This domain is found in proteins that utilise NAD as a cofactor and use nucleotide-sugar substrates for a variety of chemical reactions [ (PUBMED:9174344) ]. One of the best studied of these proteins is UDP-galactose 4-epimerase which catalyses the conversion of UDP-galactose to UDP-glucose during galactose metabolism [ (PUBMED:11279032) (PUBMED:10801319) ].

GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Epimerase