The domain within your query sequence starts at position 25 and ends at position 128; the E-value for the EpoR_lig-bind domain shown below is 1.4e-32.

SQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSGTYQLLYAYRGEKPRACPLYSQSV
PTFGTRYVCQFPAQDEVRLFFPLHLWVKNVSLNQTLIQRVLFVD

EpoR_lig-bind

EpoR_lig-bind
PFAM accession number:PF09067
Interpro abstract (IPR015152):

Members of this entry include the growth hormone and erythropoietin receptors. The latter interacts with erythropoietin (EPO), with subsequent initiation of the downstream chain of events associated with binding of EPO to the receptor, including EPO-induced erythroblast proliferation and differentiation through induction of the JAK2/STAT5 signalling cascade. The domain adopts a secondary structure composed of a short amino-terminal helix, followed by two beta-sandwich regions [(PUBMED:9774108)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EpoR_lig-bind