The domain within your query sequence starts at position 5 and ends at position 54; the E-value for the Erg28 domain shown below is 1.5e-14.
LNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFG
Erg28 |
---|
PFAM accession number: | PF03694 |
---|---|
Interpro abstract (IPR005352): | This is a family of integral membrane proteins, which may contain four transmembrane helices. Members of this family are thought to be involved in sterol C-4 demethylation. In Saccharomyces cerevisiae (Baker's yeast) they may tether Erg26p (sterol dehydrogenase/decarboxylase) and Erg27p (3-ketoreductase) to the endoplasmic reticulum or may facilitate interaction between these proteins [ (PUBMED:11160377) ]. The family contains a conserved arginine and histidine that may be functionally important. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Erg28