The domain within your query sequence starts at position 170 and ends at position 533; the E-value for the Exo_endo_phos domain shown below is 9.9e-27.

MSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGTE
IRPSLESLGYHCEYKMKTGRKPDGCAICFKHSRFSLLSVNPVEFCRRDIPLLDRDNIGLV
LLLQPKIPRAASPSICIANTHLLYNPRRGDIKLTQLAMLLAEIANVTHRKDGSSCPIVMC
GDFNSVPGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVY
EAQQVPKVEKTDSDVTQAQQEKAEVPVSADKVSSHLQHGFSLSSVYSHYVPDTGVPEVTT
CHSRSAITVDYIFYTAKKENTAQGPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNEHN
SSDH

Exo_endo_phos

Exo_endo_phos
PFAM accession number:PF03372
Interpro abstract (IPR005135):

This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling [(PUBMED:10838565)]. Proteins this domain is found in include: AP endonuclease proteins (EC 4.2.99.18), DNase I proteins (EC 3.1.21.1), Synaptojanin an inositol-1,4,5-trisphosphate phosphatase (EC 3.1.3.56) and Sphingomyelinase (EC 3.1.4.12).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Exo_endo_phos