The domain within your query sequence starts at position 612 and ends at position 653; the E-value for the F-box domain shown below is 2.3e-7.

DHLSSLPFEVLQHIAGFLDGFSLCQLACVSRLMRDVCGSLLQ

F-box

F-box
PFAM accession number:PF00646
Interpro abstract (IPR001810):

First identified in cyclin-F as a protein-protein interaction motif, the F-box is a conserved domain that is present in numerous proteins with a bipartite structure [(PUBMED:8706131)]. Through the F-box, these proteins are linked to the Skp1 protein and the core of SCFs (Skp1-cullin-F-box protein ligase) complexes. SCFs complexes constitute a new class of E3 ligases [(PUBMED:9346238)]. They function in combination with the E2 enzyme Cdc34 to ubiquitinate G1 cyclins, Cdk inhibitors and many other proteins, to mark them for degradation. The binding of the specific substrates by SCFs complexes is mediated by divergent protein-protein interaction motifs present in F-box proteins, like WD40 repeats, leucine rich repeats [(PUBMED:9529603), (PUBMED:10581972)] or ANK repeats.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry F-box