The domain within your query sequence starts at position 268 and ends at position 361; the E-value for the F420_oxidored domain shown below is 3.2e-9.

KIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITF
ACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMST

F420_oxidored

F420_oxidored
PFAM accession number:PF03807
Interpro abstract (IPR028939): Pyrroline-5-carboxylate reductase consists of two domains, an N-terminal catalytic domain and a C-terminal dimerisation domain. This entry represents the N-terminal catalytic domain, which consists of an alpha/beta/alpha sandwich with a canonical NADP-binding Rossmann fold [(PUBMED:16233902)]. This type of NADP-binding domain is also found in F420-dependent NADP reductases [(PUBMED:11726492)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry F420_oxidored