The domain within your query sequence starts at position 31 and ends at position 118; the E-value for the F420_oxidored domain shown below is 2.3e-17.
TVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFV AIHREHYTSLWDLRHLLVGKILIDVSNN
F420_oxidored |
---|
PFAM accession number: | PF03807 |
---|---|
Interpro abstract (IPR028939): | Pyrroline-5-carboxylate reductase consists of two domains, an N-terminal catalytic domain and a C-terminal dimerisation domain. This entry represents the N-terminal catalytic domain, which consists of an alpha/beta/alpha sandwich with a canonical NADP-binding Rossmann fold [ (PUBMED:16233902) ]. This type of NADP-binding domain is also found in F420-dependent NADP reductases [ (PUBMED:11726492) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry F420_oxidored