The domain within your query sequence starts at position 22 and ends at position 223; the E-value for the FAA_hydrolase domain shown below is 4e-65.

NIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLL
GKRGEAIPEAAAMDYVAGYALCLDMTARDVQEECKKKGLPWTLAKSFTSSCPVSAFVPKE
KIPDPHALRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGP
IKENDEIEAGIDGVVSMRFKVK

FAA_hydrolase

FAA_hydrolase
PFAM accession number:PF01557
Interpro abstract (IPR011234):

Fumarylacetoacetase (EC 3.7.1.2; also known as fumarylacetoacetate hydrolase or FAH) catalyses the hydrolytic cleavage of a carbon-carbon bond in fumarylacetoacetate to yield fumarate and acetoacetate as the final step in phenylalanine and tyrosine degradation [(PUBMED:11154690)]. This is an essential metabolic function in humans, the lack of FAH causing type I tyrosinaemia, which is associated with liver and kidney abnormalities and neurological disorders [(PUBMED:9101289), (PUBMED:16602095)]. The enzyme mechanism involves a catalytic metal ion, a Glu/His catalytic dyad, and a charged oxyanion hole [(PUBMED:10508789)]. FAH folds into two domains: an N-terminal domain SH3-like beta-barrel, and a C-terminal with an unusual fold consisting of three layers of beta-sheet structures [(PUBMED:10508789)].

This entry represents the C-terminal domain of fumarylacetoacetase, as well as other domains that share a homologous alpha/beta structure, including:

  • 5-carboxymethyl-2-hydroxymuconate delta-isomerase (CHM isomerase; EC 5.3.3.10), which catalyses the conversion of 5-carboxymethyl-2-hydroxymuconate to 5-carboxy-2-oxohept-3-enedioate [(PUBMED:2194841)].
  • 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase (OPET decarboxylase; EC 4.1.1.68), which catalyses the conversion of 5-oxopent-3-ene-1,2,5-tricarboxylate to 2-oxohept-3-enedioate and carbon dioxide.
  • Bifunctional enzyme HpcE (OPET decarboxylase EC 4.1.1.68/HHDD isomerase EC 5.3.3.10), which is a duplication consisting of a tandem repeat of two FAH C-terminal-like domains. This enzyme is responsible for the degradation of 4-hydroxyphenylacetate, a product of tyrosine and phenylalanine metabolism also released by lignin catabolism [(PUBMED:11863436)].
  • 2-keto-4-pentenoate hydratase MhpD (EC 4.2.1.80; also known as 2-oxopent-4-enoate hydratase), which converts 4-hydroxy-2-oxopentanoate to 2-oxopent-4-enoate [(PUBMED:10537203)].
  • 4-oxalocrotonate decarboxylase (4-OD; EC 4.1.1.77), which catalyses the conversion of 4-oxalocrotonate to 2-oxopent-4-enoate and carbon dioxide [(PUBMED:10651637)].
  • 2-oxo-hepta-3-ene-1,7-dioic acid hydratase, which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid.
GO process:metabolic process (GO:0008152)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAA_hydrolase