The domain within your query sequence starts at position 750 and ends at position 978; the E-value for the FAD_binding_1 domain shown below is 2.1e-82.
THVHRRKMFQATILSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIGVCPPNRPGLV EALLSRVEDPPPSTEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTYFLDITSPPS PRLLRLLSTLAEESSEQQELEALSQDPRRYEEWKWFSCPTLLEVLEQFPSVALPAPLILT QLPLLQPRYYSVSSAPSAHPGEIHLTIAVLAYRTQDGLGPLHYGVCSTW
FAD_binding_1 |
![]() |
---|
PFAM accession number: | PF00667 |
---|---|
Interpro abstract (IPR003097): | This domain is found in sulphite reductase, NADPH cytochrome P450 reductase, nitric oxide synthase and methionine synthase reductase. Flavoprotein pyridine nucleotide cytochrome reductases [(PUBMED:1748631)] (FPNCR) catalyse the interchange of reducing equivalents between one-electron carriers and the two-electron-carrying nicotinamide dinucleotides. The enzymes include ferredoxin:NADP+reductases (FNR) [(PUBMED:8027025)], plant and fungal NAD(P)H:nitrate reductases [(PUBMED:1748631), (PUBMED:12165428)], NADH:cytochrome b5 reductases [(PUBMED:3700359)], NADPH:P450 reductases [(PUBMED:1908607)], NADPH:sulphite reductases [(PUBMED:2550423)], nitric oxide synthases [(PUBMED:1712077)], phthalate dioxygenase reductase [(PUBMED:8298460)], and various other flavoproteins. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_1