The domain within your query sequence starts at position 750 and ends at position 978; the E-value for the FAD_binding_1 domain shown below is 2.1e-82.

THVHRRKMFQATILSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIGVCPPNRPGLV
EALLSRVEDPPPSTEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTYFLDITSPPS
PRLLRLLSTLAEESSEQQELEALSQDPRRYEEWKWFSCPTLLEVLEQFPSVALPAPLILT
QLPLLQPRYYSVSSAPSAHPGEIHLTIAVLAYRTQDGLGPLHYGVCSTW

FAD_binding_1

 FAD_binding_1
PFAM accession number:PF00667
Interpro abstract (IPR003097):

This domain is found in sulphite reductase, NADPH cytochrome P450 reductase, nitric oxide synthase and methionine synthase reductase. Flavoprotein pyridine nucleotide cytochrome reductases [(PUBMED:1748631)] (FPNCR) catalyse the interchange of reducing equivalents between one-electron carriers and the two-electron-carrying nicotinamide dinucleotides. The enzymes include ferredoxin:NADP+reductases (FNR) [(PUBMED:8027025)], plant and fungal NAD(P)H:nitrate reductases [(PUBMED:1748631), (PUBMED:12165428)], NADH:cytochrome b5 reductases [(PUBMED:3700359)], NADPH:P450 reductases [(PUBMED:1908607)], NADPH:sulphite reductases [(PUBMED:2550423)], nitric oxide synthases [(PUBMED:1712077)], phthalate dioxygenase reductase [(PUBMED:8298460)], and various other flavoproteins.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_1