The domain within your query sequence starts at position 93 and ends at position 140; the E-value for the FAD_binding_2 domain shown below is 1.7e-6.

KVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVA

FAD_binding_2

FAD_binding_2
PFAM accession number:PF00890
Interpro abstract (IPR003953):

This domain is found in proteins that bind FAD, mainly in FAD-dependent oxidoreductase family 2 proteins, such as the flavoprotein subunits from succinate and fumarate dehydrogenase, and aspartate oxidase [ (PUBMED:8061609) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD_binding_2